PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013597006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 393aa    MW: 45842.7 Da    PI: 7.6485
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013597006.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.9e-17183229148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEd + ++ v+++G + W+ Ia+ ++ gR +kqc++rw+++l
   XP_013597006.1 183 KGQWTSEEDRIVIQFVEKYGLRKWSHIAQVLP-GRIGKQCRERWHNHL 229
                      799*****************************.*************97 PP

2Myb_DNA-binding52.21.4e-16235277145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +  W++eEd  l++ +k+ G++ W+ Ia++++ gRt++++k++w+
   XP_013597006.1 235 KETWSEEEDRVLIQFHKEIGNK-WAEIAKRLP-GRTENSIKNHWN 277
                      578*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.803178233IPR017930Myb domain
SuperFamilySSF466893.34E-31181276IPR009057Homeodomain-like
SMARTSM007174.6E-16182231IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.9E-28184236IPR009057Homeodomain-like
CDDcd001672.09E-14186229No hitNo description
PfamPF139217.3E-19186243No hitNo description
PROSITE profilePS5129421.134234284IPR017930Myb domain
SMARTSM007173.6E-16234282IPR001005SANT/Myb domain
CDDcd001673.45E-12237280No hitNo description
Gene3DG3DSA:1.10.10.603.0E-22237282IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MENYVGESGF APLNKTVFTR DQEQMKEENF PFQVVDQSKP TSFLQDFQHL DHDHQFDHHH  60
HHHGSTSSNP LLGIQTRPSC VNSSLFEHCA YQDNMVNMVN KHGPMDMKQD NMMMGMISFD  120
YPPREITKPM NFVMPDEVSC VSADNDCYKS MSFNKTKPIL TRKLSSSSSS SSWKEKKETT  180
LVKGQWTSEE DRIVIQFVEK YGLRKWSHIA QVLPGRIGKQ CRERWHNHLR PDIKKETWSE  240
EEDRVLIQFH KEIGNKWAEI AKRLPGRTEN SIKNHWNATK RRQFSKRKCR SKYPRPSLLQ  300
DYIKSLDLKA LSFSSVPARG RRRESNKKKD FVAVEEENKK NEDDLYGLDR MVPECVFTDD  360
FGFNEKLLVE GCSIDSLLDD LPQPDTDTFA HGF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C5e-461812832104C-Myb DNA-Binding Domain
1msf_C5e-461812832104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013597006.10.0PREDICTED: transcription factor MYB98-like
SwissprotQ9S7L20.0MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A0D3DEX60.0A0A0D3DEX6_BRAOL; Uncharacterized protein
STRINGBra012579.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58692847
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.10.0myb domain protein 98